Fortbelknap.mpqhf.com is a subdomain of mpqhf.com, which was created on 2007-01-26,making it 17 years ago. It has several subdomains, such as blackfeet.mpqhf.com , among others.
Discover fortbelknap.mpqhf.com website stats, rating, details and status online.Use our online tools to find owner and admin contact info. Find out where is server located.Read and write reviews or vote to improve it ranking. Check alliedvsaxis duplicates with related css, domain relations, most used words, social networks references. Go to regular site
HomePage size: 75.803 KB |
Page Load Time: 0.369965 Seconds |
Website IP Address: 104.207.254.43 |
CTUIR GIS Program gis.ctuir.org |
Education Events | Health Events | Smart City Events events.eletsonline.com |
Booking a Reservation - Expressway Airport Parking reservations.expresswayparking.com |
Calendar of Allergy Asthma Network Events | Webinars, In-Person Events, Virtual Events, and NOML Eve calendar.allergyasthmanetwork.org |
Upcoming Events in Moreno Valley, CA (92555) | Press Enterprise Events - Events – Press Enterprise event.pe.com |
New Mexico Events Calendar, Albuquerque Events Calendar, Santa Fe Events Calendar | KOB.com events.kob.com |
Southwest Florida Welcome Guide-Map - Fort Myers & Naples Florida Guide & Map southwestflorida.welcomeguide-map.com |
New Reservation -
DCoL Events & Room Reservations -
Durham County Library rooms.durhamcountylibrary.org |
A guide to the organizations and events of the Blackfeet Reservation blackfeet.mpqhf.com |
Bowdoin Student Organizations | web hosting for student organizations students.bowdoin.edu |
Student Events, Clubs and Organizations | Student Activities, Involvement, and Leadership | Providen student-activities.providence.edu |
AB Events - American Bazaar Events Venture Capitals, Startup Events, Investment Forum, Philanthropy abevents.americanbazaaronline.com |
Live! 360 Events Home: 6 Great Events, 1 Low Price! -- Live! 360 Events www2.live360events.com |
Welcome to Wansport.com – David Ensignia Tennis Academy – Online reservation and sports centers davidensigniatennisacademy.wansport.com |
A guide to the organizations and events of the Fort Belknap ... https://fortbelknap.mpqhf.com/ |
User Tips https://fortbelknap.mpqhf.com/user-tips/ |
Events https://fortbelknap.mpqhf.com/events/ |
Community Resources https://fortbelknap.mpqhf.com/community-resources/ |
Event Map https://fortbelknap.mpqhf.com/event-map/ |
Definitions https://fortbelknap.mpqhf.com/definitions/ |
Server: nginx |
Date: Mon, 13 May 2024 16:53:13 GMT |
Content-Type: text/html; charset=UTF-8 |
Transfer-Encoding: chunked |
Connection: keep-alive |
Vary: Accept-Encoding |
Expires: Wed, 11 Jan 1984 05:00:00 GMT |
Cache-Control: no-cache, must-revalidate, max-age=0 |
Pragma: no-cache |
Link: https://fortbelknap.mpqhf.com/; rel=shortlink |
X-Cache-NxAccel: BYPASS |
charset="utf-8"/ |
content="width=device-width, initial-scale=1" name="viewport"/ |
content="max-image-preview:large" name="robots" |
content="WordPress 6.5.3" name="generator" |
Ip Country: United States |
Latitude: 37.751 |
Longitude: -97.822 |
Home Community Resources Events Event Map Definitions User Tips Scroll down to content Welcome Fort Belknap Connections About the Fort Belknap Connections map Finding a health care service or community event on the Fort Belknap Reservation has never been easier, thanks to the Fort Belknap Connections resource map. You will find community events and health care and support services displayed on Google Maps with the addresses, times and contact information. Whether it is Fort Belknap culture, businesses, food, health, music or nature-related events, Fort Belknap Connections is your one-stop shop for finding important events and places on the Fort Belknap Reservation. Do you want to share an event? Just fill out some basic information and submit your event by clicking on the Add Your Event!” button. Fort Belknap Connections is 100 percent free. About Mountain-Pacific Quality Health Mountain-Pacific Quality Health (Mountain-Pacific) is a 501(c)(3) nonprofit corporation and holds federal and state contracts that allow them to oversee the quality of care for Medicare and Medicaid members. Mountain-Pacific works within its region (Montana, Wyoming, Alaska, Hawaii and the U.S. Pacific Territories of Guam and American Samoa and the Commonwealth of the Northern Mariana Islands) to help improve the delivery of health care and the systems that provide it. Mountain-Pacific’s goal is to increase access to high-quality health care that is affordable, safe and of value to the patients they serve. Please reference the Mountain-Pacific website at www.mpqhf.org for more information. About the Partnership to Advance Tribal Health (PATH) project PATH is funded by the Centers for Medicare & Medicaid Services (CMS), an agency of the U.S. Department of Health and Human Services, to work specifically with Indian Health Service (IHS) hospitals certified by Medicare to improve health and health care in their communities. HealthInsight, a Medicare Quality Innovation Network-Quality Improvement Organization, oversees the project with support of the local quality improvement organizations in each state. Mountain-Pacific is managing the project in the state of Montana. PATH team members work with hospital leaders to improve quality and develop patient-centered approaches that treat the whole person with respect to culture, traditions and personal wishes. Fort Belknap Connections was created out of the PATH project. System requirements Fort Belknap Connections can be accessed from any device or web browser, and it does not require any web browser configuration to access and use the application. Developed by Mountain-Pacific Quality Health, the Medicare Quality Innovation Network-Quality Improvement Organization (QIN-QIO) for Montana, Wyoming, Alaska, Hawaii and the U.S. Pacific Territories of Guam and American Samoa and the Commonwealth of the Northern Mariana Islands, under contract with the Centers for Medicare & Medicaid Services (CMS), an agency of the U.S. Department of Health and Human Services. Contents presented do not necessarily reflect CMS policy. Proudly powered by...
Domain Name: MPQHF.COM Registry Domain ID: 777987858_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.ionos.com Registrar URL: http://www.ionos.com Updated Date: 2024-01-27T08:48:26Z Creation Date: 2007-01-26T22:18:03Z Registry Expiry Date: 2025-01-26T22:18:03Z Registrar: IONOS SE Registrar IANA ID: 83 Registrar Abuse Contact Email: abuse@ionos.com Registrar Abuse Contact Phone: +1.6105601459 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Name Server: NS1087.UI-DNS.BIZ Name Server: NS1087.UI-DNS.COM Name Server: NS1087.UI-DNS.DE Name Server: NS1087.UI-DNS.ORG DNSSEC: unsigned >>> Last update of whois database: 2024-05-17T20:13:57Z <<<